DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and AGD11

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_187405.1 Gene:AGD11 / 819937 AraportID:AT3G07490 Length:153 Species:Arabidopsis thaliana


Alignment Length:146 Identity:42/146 - (28%)
Similarity:67/146 - (45%) Gaps:18/146 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DADEIRRLGKRFRKLDLDNSGALSIDEFMSLPE-----LQQNPLVQRVIDIFDADGNGEVDFKEF 75
            |..|:.|:   |:..|.:..|.::..|.....|     :....||| :|:..|.:|:|.||.:||
plant     2 DQAELARI---FQMFDRNGDGKITKQELNDSLENLGIYIPDKDLVQ-MIEKIDLNGDGYVDIEEF 62

  Fly    76 IQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLK---MMVGNNLKDTQLQQIVDKTI 137
            ...........|:...:|.||.::|.:.||:|:..||..||.   :..|..|:|.:      :.|
plant    63 GGLYQTIMEERDEEEDMREAFNVFDQNRDGFITVEELRSVLASLGLKQGRTLEDCK------RMI 121

  Fly   138 CFADKDEDGKISFDEF 153
            ...|.|.||.::|.||
plant   122 SKVDVDGDGMVNFKEF 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 42/146 (29%)
AGD11NP_187405.1 PTZ00184 4..141 CDD:185504 41/144 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.