DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and Cib1

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_038948271.1 Gene:Cib1 / 81823 RGDID:620133 Length:203 Species:Rattus norvegicus


Alignment Length:128 Identity:37/128 - (28%)
Similarity:71/128 - (55%) Gaps:5/128 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LSIDEFMSLPELQQNPLVQRVIDIFDADGNGE-VDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDM 101
            :|.::.:|||||:.||..:|:..:|......: :.|::|:..:|.||.......|..:||||:|.
  Rat    53 VSFEQILSLPELKANPFKERICMVFSTSPTRDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDF 117

  Fly   102 DNDGYISNGELFQVLKMMVG----NNLKDTQLQQIVDKTICFADKDEDGKISFDEFCSVVGNT 160
            |:||.:...:|.:::..:.|    ..|..::::|::|..:..:|.|.||.|:..||..|:..:
  Rat   118 DDDGTLDREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 35/120 (29%)
Cib1XP_038948271.1 EFh 111..178 CDD:238008 21/66 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.