DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and rcvrnb

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001304684.1 Gene:rcvrnb / 792903 ZFINID:ZDB-GENE-120815-1 Length:203 Species:Danio rerio


Alignment Length:192 Identity:54/192 - (28%)
Similarity:93/192 - (48%) Gaps:26/192 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNETS--LPMDM------CSNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSL-----PELQQN 52
            |||..|  |..|:      .:.:..:::....::|  |:...:|.:|.::|.|:     |:....
Zfish     1 MGNSRSSALSRDVLQELQTSTTYSQEQLFSWYQKF--LNECPTGRISREQFQSIYASFFPDADPG 63

  Fly    53 PLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLK 117
            ...|.|...||||.:|.:||||:|..: ..:..|..:.||.:||.:||:|.:|.|:..|:.:::|
Zfish    64 AYAQHVFRSFDADSDGTLDFKEYIVAL-HLTSSGKTVEKLEWAFALYDVDRNGSITKNEIHEIVK 127

  Fly   118 MMVG-------NNLKDTQ--LQQIVDKTICFADKDEDGKISFDEFC-SVVGNTDIHKKMVVD 169
            .:..       .||.|.:  .::..||...|..|.|:|||:..||. .|:.|..|.:.:..|
Zfish   128 SIFNMISKEDQKNLPDDENTPEKRTDKIWDFFGKKENGKITEGEFIQGVMDNKHILRLIQFD 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 43/154 (28%)
rcvrnbNP_001304684.1 FRQ1 10..182 CDD:227455 47/174 (27%)
EFh 65..127 CDD:238008 23/62 (37%)
EFh 101..177 CDD:238008 24/75 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.