DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and Tescl

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001157282.1 Gene:Tescl / 69301 MGIID:1916551 Length:231 Species:Mus musculus


Alignment Length:196 Identity:47/196 - (23%)
Similarity:91/196 - (46%) Gaps:40/196 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MDMCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDAD---GNG-- 68
            ::.| :|..::|::|.:|||.|..|.. .|..:.|.::.:|:.||:..|::..|..:   |.|  
Mouse    28 LNKC-DFSWEQIKQLHQRFRLLSGDQP-TLQPESFDNILDLEFNPIRSRIVRAFFDNRNLGKGTS 90

  Fly    69 ----EVDFKEFIQGVSQF----------SVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMM 119
                |:.|::|:..:|.|          ....::..|:||.|.:||.|.||.|:..|..:|::.:
Mouse    91 GLAEEITFQDFLTIISYFRPLRPSLNKEEAEQNRKDKMRFLFNMYDQDGDGIITLQEYRRVVESL 155

  Fly   120 --------------VGNNLKDTQLQQIV---DKTICFADKDEDGKISFDEFCSVVGNTDIHKKMV 167
                          |.|.:....|::..   |:.: .|.:..:| |:|::|.....:.::..||.
Mouse   156 LSAHPQVERDTVRSVANAIAQGALKEAARASDQPL-MAGQQYEG-ITFEDFVKTWKSLELEVKMQ 218

  Fly   168 V 168
            |
Mouse   219 V 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 42/176 (24%)
TesclNP_001157282.1 FRQ1 24..>155 CDD:227455 35/128 (27%)
EFh 127..>155 CDD:298682 12/27 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.