DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and CHP2

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_071380.1 Gene:CHP2 / 63928 HGNCID:24927 Length:196 Species:Homo sapiens


Alignment Length:201 Identity:68/201 - (33%)
Similarity:102/201 - (50%) Gaps:38/201 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNETS----LPMDMCSNFDADEIR-----------RLGKRFRKLDLDNSGALSIDEFMSLPELQ 50
            ||:.:|    :|       |.|.||           ||..|||.||.:..|.||..:...:..|.
Human     1 MGSRSSHAAVIP-------DGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALA 58

  Fly    51 QNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVRGD----------------KLSKLRFAFRIY 99
            .|||..|:|:.|..||:..|||..|::.::.|....|                :.:||.:||::|
Human    59 VNPLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAFQLY 123

  Fly   100 DMDNDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTICFADKDEDGKISFDEFCSVVGNTDIHK 164
            |:|.||.||..|:.|||::|||..:.:.||:.|.|:|:..||:|.||.:||.||...:...|:.:
Human   124 DLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKSLEKMDVEQ 188

  Fly   165 KMVVDV 170
            ||.:.:
Human   189 KMSIRI 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 60/167 (36%)
CHP2NP_071380.1 FRQ1 16..179 CDD:227455 59/162 (36%)
Nuclear export signal 137..148 6/10 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.