DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and Tesc

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_067319.2 Gene:Tesc / 57816 MGIID:1930803 Length:214 Species:Mus musculus


Alignment Length:184 Identity:45/184 - (24%)
Similarity:88/184 - (47%) Gaps:31/184 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDADGN---------G 68
            :.|.:|:|.:|.:||::|..|.. .:..:.|.::|:|:.||:..:::..|..:.|         .
Mouse    18 TGFSSDQIEQLHRRFKQLSGDQP-TIRKENFNNVPDLELNPIRSKIVRAFFDNRNLRKGSSGLAD 81

  Fly    69 EVDFKEFIQGVSQF----------SVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNN 123
            |::|::|:..:|.|          .|...:..||:|.|.:||.|:||.|:..|...|::.::..|
Mouse    82 EINFEDFLTIMSYFRPIDTTLGEEQVELSRKEKLKFLFHMYDSDSDGRITLEEYRNVVEELLSGN 146

  Fly   124 --LKDTQLQQIVD------KTICFADKDED---GKISFDEFCSVVGNTDIHKKM 166
              ::....:.|.|      .::|....:.|   ..|:|::|..:....||..||
Mouse   147 PHIEKESARSIADGAMMEAASVCVGQMEPDQVYEGITFEDFLKIWQGIDIETKM 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 40/170 (24%)
TescNP_067319.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 0/1 (0%)
FRQ1 20..>142 CDD:227455 33/122 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.