DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and rcvrna

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001025419.1 Gene:rcvrna / 570333 ZFINID:ZDB-GENE-050913-106 Length:203 Species:Danio rerio


Alignment Length:150 Identity:42/150 - (28%)
Similarity:73/150 - (48%) Gaps:16/150 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SGALSIDEFMSL-----PELQQNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRF 94
            ||.::.::|..:     |:.......:.|...||.:.:|.:||||:|..: ..:..|..|.||.:
Zfish    41 SGRITKEQFEGIYASFFPDADPTAYARHVFRSFDTNADGTLDFKEYIVAL-HLTSSGKTLRKLEW 104

  Fly    95 AFRIYDMDNDGYISNGELFQVLKMMVG-------NNLKDTQ--LQQIVDKTICFADKDEDGKISF 150
            ||.:||:|.:|.||..|:.::::.:..       .||.|.:  .::..||...|..|.::.||..
Zfish   105 AFALYDVDGNGTISKNEVQEIVRSIFNMVPVEDQKNLPDDENTPEKRADKIWAFFGKQDNDKIGE 169

  Fly   151 DEFC-SVVGNTDIHKKMVVD 169
            .||. .|:.|.||.:.:..|
Zfish   170 GEFIQGVMENKDILRLIQYD 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 36/132 (27%)
rcvrnaNP_001025419.1 FRQ1 13..182 CDD:227455 39/141 (28%)
EFh 65..127 CDD:238008 22/62 (35%)
EFh 101..177 CDD:238008 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.020

Return to query results.
Submit another query.