DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and Kcnip2

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_064479.2 Gene:Kcnip2 / 56817 RGDID:70887 Length:270 Species:Rattus norvegicus


Alignment Length:131 Identity:33/131 - (25%)
Similarity:69/131 - (52%) Gaps:13/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SGALSIDEFMSL-----PELQQNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRF 94
            ||.::.:.|..:     |:...:.....:.:.||.:.:|.|.|::|:.|:|.. :||....:|.:
  Rat   120 SGIVNEENFKQIYSQFFPQGDSSNYATFLFNAFDTNHDGSVSFEDFVAGLSVI-LRGTIDDRLSW 183

  Fly    95 AFRIYDMDNDGYISNGELFQVLKM---MVGN----NLKDTQLQQIVDKTICFADKDEDGKISFDE 152
            ||.:||::.||.|:..|:..::|.   |:|.    .|::...::.|:......|:::||.::.:|
  Rat   184 AFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEE 248

  Fly   153 F 153
            |
  Rat   249 F 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 33/131 (25%)
Kcnip2NP_064479.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
FRQ1 93..259 CDD:227455 33/131 (25%)
Interaction with KCND2. /evidence=ECO:0000250|UniProtKB:Q8R426 257..270
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.