DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and Chp1

DIOPT Version :10

Sequence 1:NP_524741.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_062743.1 Gene:Chp1 / 56398 MGIID:1927185 Length:195 Species:Mus musculus


Alignment Length:171 Identity:70/171 - (40%)
Similarity:99/171 - (57%) Gaps:15/171 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDADGNGEVDFKEFIQ 77
            :.|...:|.||..||..||...:|.||.::|..:|||..|||..|:|:.|.::|..:|:|:.|::
Mouse    21 TGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFSEGEDQVNFRGFMR 85

  Fly    78 GVSQF----------SVRG-----DKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDT 127
            .::.|          .|.|     .:.:||.||||:||:|.|..||..||.|||:||||.|:.|.
Mouse    86 TLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDDKISRDELLQVLRMMVGVNISDE 150

  Fly   128 QLQQIVDKTICFADKDEDGKISFDEFCSVVGNTDIHKKMVV 168
            ||..|.|:||..||:|.|..|||.||..|:...|:.:||.:
Mouse   151 QLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_524741.1 FRQ1 20..157 CDD:444056 65/151 (43%)
Chp1NP_062743.1 Necessary for association with microtubule and interaction with GAPDH. /evidence=ECO:0000250 2..6
FRQ1 27..182 CDD:444056 66/154 (43%)
Nuclear export signal 1. /evidence=ECO:0000250 138..147 6/8 (75%)
Nuclear export signal 2. /evidence=ECO:0000250 176..185 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.