DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and si:ch211-245j22.3

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001074270.1 Gene:si:ch211-245j22.3 / 563798 ZFINID:ZDB-GENE-050419-38 Length:194 Species:Danio rerio


Alignment Length:180 Identity:49/180 - (27%)
Similarity:88/180 - (48%) Gaps:18/180 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNETSLPMDMCSNFDADEIRRLGKRFRK-LDLDNSGALSIDEFM-----SLPELQQNPLVQRVI 59
            ||...:||......:    :..|.:.||| |:...||.:::.||.     .....:.....:::.
Zfish     1 MGQTATLPCRKGGTY----VIELYEWFRKFLNECPSGLITLHEFRRHFCNGTVGKESAEYAEQIF 61

  Fly    60 DIFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVL----KMMV 120
            ...|.:|:|.|||:|::..:|.. :.|..:.|||::|::||.|.||.|:..|:.:::    ||.|
Zfish    62 RTLDNNGDGVVDFREYVTAISML-IEGSTVEKLRWSFKLYDKDKDGAITRSEMLEIMQAVYKMSV 125

  Fly   121 GNNL-KDTQL--QQIVDKTICFADKDEDGKISFDEFCSVVGNTDIHKKMV 167
            ..:| |...|  ::..::.....|||.:..||.|||.....|.:..::|:
Zfish   126 AASLTKPDPLTAEECTNRIFVRLDKDNNAIISQDEFIEGALNDEWIREML 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 42/153 (27%)
si:ch211-245j22.3NP_001074270.1 EF-hand_8 31..78 CDD:290545 11/46 (24%)
EF-hand_7 32..81 CDD:290234 11/48 (23%)
EFh 56..118 CDD:238008 20/62 (32%)
EF-hand_7 57..117 CDD:290234 20/60 (33%)
EFh 92..164 CDD:238008 25/71 (35%)
EF-hand_7 93..163 CDD:290234 24/69 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.