DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and Hpcal1

DIOPT Version :10

Sequence 1:NP_524741.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_057886.1 Gene:Hpcal1 / 53602 MGIID:1855689 Length:193 Species:Mus musculus


Alignment Length:36 Identity:9/36 - (25%)
Similarity:13/36 - (36%) Gaps:0/36 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FLCPHKLAPIYNFMIDNPQEGRLSRKRKKLKICESI 37
            |:..||.........|.|....||...|:..:..|:
Mouse   136 FMLKHKQVEPAQMAYDRPSPKFLSFLEKRYDLRNSV 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_524741.1 FRQ1 20..157 CDD:444056 4/18 (22%)
Hpcal1NP_057886.1 FRQ1 21..175 CDD:444056 9/36 (25%)

Return to query results.
Submit another query.