DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and guca1g

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001011660.1 Gene:guca1g / 494572 ZFINID:ZDB-GENE-050120-1 Length:187 Species:Danio rerio


Alignment Length:144 Identity:41/144 - (28%)
Similarity:76/144 - (52%) Gaps:14/144 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNP-----LVQRVIDIFDADGNGEVDFKEFIQG 78
            ||:.|..||.|  :..||||.:.||..:..:|.:.     .::.:...||.:.:..:||.||:..
Zfish    17 EIQPLYTRFMK--VCPSGALHLHEFRRIFGVQSSSEEEALYMETIFKSFDTNRDNVIDFMEFVAA 79

  Fly    79 VSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQLQ----QIVDKTICF 139
            | ...:||:...:|:::|::||.|.:|.:...|:..|::::.  .||..::.    :|.|:....
Zfish    80 V-HLVLRGNLEDRLKWSFKVYDRDENGKLDRQEVIHVIRILC--KLKKNRINMTPVEICDRIFEL 141

  Fly   140 ADKDEDGKISFDEF 153
            .|::.||:||..||
Zfish   142 LDENNDGQISLSEF 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 41/144 (28%)
guca1gNP_001011660.1 EF-hand_8 30..80 CDD:290545 13/49 (27%)
EFh 59..117 CDD:238008 17/58 (29%)
EFh 91..158 CDD:238008 19/67 (28%)
EF-hand_7 92..157 CDD:290234 19/66 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.