DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and chp1

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001004859.1 Gene:chp1 / 448152 XenbaseID:XB-GENE-1007598 Length:193 Species:Xenopus tropicalis


Alignment Length:169 Identity:69/169 - (40%)
Similarity:97/169 - (57%) Gaps:13/169 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDADGNGEVDFKEFIQ 77
            :.|...:|.||..||..||...:|.||.::|..:|||..|||..|:|:.|..:|..:|:|:.|::
 Frog    21 TGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFTEGEDQVNFRGFMR 85

  Fly    78 GVSQFSVRGD-------------KLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQL 129
            .::.|....|             :.:||.||||:||:|.|..||..||.|||:||||.|:.|.||
 Frog    86 TLAHFRPIEDNSKDANSQEPLNSRSNKLLFAFRLYDLDKDDKISREELLQVLRMMVGVNISDDQL 150

  Fly   130 QQIVDKTICFADKDEDGKISFDEFCSVVGNTDIHKKMVV 168
            ..|.|:||..||:|.|..|||.||..|:...|:.:||.:
 Frog   151 GSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSI 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 64/153 (42%)
chp1NP_001004859.1 FRQ1 1..180 CDD:227455 66/158 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.