DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and d-cup

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_650235.1 Gene:d-cup / 41580 FlyBaseID:FBgn0038089 Length:219 Species:Drosophila melanogaster


Alignment Length:153 Identity:39/153 - (25%)
Similarity:77/153 - (50%) Gaps:14/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FDADEIRRLGKRFRKLDLDNSGA---LSIDEFMSL----PELQQNPLVQRVIDIFDADGNGEVDF 72
            |:..|:..:...:.|..|.|..:   ::..:|:::    .:|....:|.|::.:. |.|...|..
  Fly    32 FNDSEVTCILMIYYKYSLQNGPSARRITSSQFVNIVIGFQQLYDMDVVDRIVTLI-AGGRKHVTP 95

  Fly    73 KEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELF--QVLKMMVGNNLKDTQLQ-QIVD 134
            .||:..::....| |...|:.||:.:||.:..|.  |.|:.  .|.:..||::.:..::: .:||
  Fly    96 MEFVNYMTILMSR-DMERKMEFAYMVYDKNGMGI--NREIISSSVERFFVGDDDEVLEMRLDMVD 157

  Fly   135 KTICFADKDEDGKISFDEFCSVV 157
            ..:...|:|:||.|||:|:.|:|
  Fly   158 FLLLKFDEDQDGYISFEEYRSIV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 37/148 (25%)
d-cupNP_650235.1 EF-hand_7 114..180 CDD:290234 21/67 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.