DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and ppp3r1

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_989400.1 Gene:ppp3r1 / 395037 XenbaseID:XB-GENE-948794 Length:170 Species:Xenopus tropicalis


Alignment Length:170 Identity:146/170 - (85%)
Similarity:159/170 - (93%) Gaps:0/170 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNETSLPMDMCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDAD 65
            ||||.|.|::|||:||||||:||||||:||||||||:||::||||||||||||||||||||||.|
 Frog     1 MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTD 65

  Fly    66 GNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQLQ 130
            |||||||||||:|||||||:|||..||||||||||||.|||||||||||||||||||||||||||
 Frog    66 GNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ 130

  Fly   131 QIVDKTICFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV 170
            |||||||..||||.||:|||:|||:|||..||||||||||
 Frog   131 QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 123/140 (88%)
ppp3r1NP_989400.1 FRQ1 13..157 CDD:227455 125/143 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5580
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68099
Inparanoid 1 1.050 302 1.000 Inparanoid score I2627
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 1 1.000 - - otm47561
Panther 1 1.100 - - O PTHR45942
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R164
SonicParanoid 1 1.000 - - X1796
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.