DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and CG3565

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster


Alignment Length:171 Identity:42/171 - (24%)
Similarity:74/171 - (43%) Gaps:34/171 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDAD------------ 65
            |.|..:|:..:...:.|..|.|....   ::|::.:|  :.|::.:.:|.|.|            
  Fly    31 SIFSHNELISIVMLYHKFVLVNGPRA---KYMTIQQL--SALMELLFEIVDRDLIATIVYRIAHT 90

  Fly    66 -GNGEVDF--------KEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGEL--FQVLKMM 119
             |:...||        :.|::..:.:..: |...|:.|||.:|| .:|....|||.  |.|.|..
  Fly    91 PGSRPPDFFSDKHIHLESFVRLFTVYFTK-DLQLKMEFAFSVYD-KSDSKQLNGEQVGFFVGKFF 153

  Fly   120 VGNNLKDTQLQQIVD-KTICFA--DKDEDGKISFDEFCSVV 157
            ...: :|..::..:| |.:.|.  |.|:|..|..||:..||
  Fly   154 ESED-EDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVV 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 40/166 (24%)
CG3565NP_611942.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.