DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and Cib2

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster


Alignment Length:175 Identity:63/175 - (36%)
Similarity:93/175 - (53%) Gaps:18/175 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNE----TSLPMD---MCSNFDADEIRRLGKRFRKLDLD-----------NSGALSIDEFMSLP 47
            |||:    |...:|   .|:.|...||.|:.||||:|..|           :|..:..:....:|
  Fly     1 MGNKVVTFTEQELDDYQDCTFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKMP 65

  Fly    48 ELQQNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGEL 112
            ||::||..:|:.:.|..||.|.:.|::|:..:|.||.:..:..|:.:||:|||.|.||:|.:.:|
  Fly    66 ELRENPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHADL 130

  Fly   113 FQVLKMMVGNNLKDTQLQQIVDKTICFADKDEDGKISFDEFCSVV 157
            ...|..|..|.|...:.|||.||.|..||.|.|||:|..||..|:
  Fly   131 MSCLTTMTKNELSPEEHQQIADKVIEEADVDGDGKLSILEFEHVI 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 55/151 (36%)
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 57/156 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464105
Domainoid 1 1.000 52 1.000 Domainoid score I4251
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.