DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and rcvrn2

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_956258.1 Gene:rcvrn2 / 335650 ZFINID:ZDB-GENE-030131-7590 Length:193 Species:Danio rerio


Alignment Length:187 Identity:48/187 - (25%)
Similarity:87/187 - (46%) Gaps:27/187 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNETSLPMD--------MCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSL-----PELQQN 52
            |||..|..|.        :.:.|..:|:.:..:.|:|  ...||.::.:||..:     ||....
Zfish     1 MGNAKSSAMSKEILEDLKLNTKFSENELSQWYENFQK--QCPSGRITPEEFKKIYERFFPECDTT 63

  Fly    53 PLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLK 117
            ...|.|...||.:.:|.:||||:|..:...|. |....||.:||.::|:|.:|||:..|:.::.:
Zfish    64 SYAQHVFRSFDTNDDGTLDFKEYIIALHMTST-GKTERKLEWAFSLFDVDKNGYITKSEVAEICQ 127

  Fly   118 MMVGNNLKDTQ---------LQQIVDKTICFADKDEDGKISFDEFC-SVVGNTD-IH 163
            .:.....|:.|         .::..||...:.:|.::.:::..||. .::.|.| ||
Zfish   128 AIFKLIPKEDQESLPADENTPEKRADKLWSYFNKKDNERLAEGEFIQGILENEDAIH 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 38/154 (25%)
rcvrn2NP_956258.1 FRQ1 14..181 CDD:227455 40/169 (24%)
EF-hand_8 40..87 CDD:290545 15/46 (33%)
EFh 65..125 CDD:238008 22/60 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.020

Return to query results.
Submit another query.