DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and Guca1b

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001101668.1 Gene:Guca1b / 316218 RGDID:1308191 Length:201 Species:Rattus norvegicus


Alignment Length:154 Identity:40/154 - (25%)
Similarity:76/154 - (49%) Gaps:22/154 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EIRRLGKRFRKLDLD-NSGALSIDEFMSLPELQQN----PLVQRVIDIFDADGNGEVDFKEFIQG 78
            ::..|.:.::|..:: .||.|.:.||....::..|    ..|:.:...||.:|:..:||.|::..
  Rat    17 DVAELQEWYKKFVVECPSGTLFMHEFKRFFKVTGNEEATQYVEGMFRAFDKNGDNTIDFLEYVAA 81

  Fly    79 VSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDT-----------QL--- 129
            :: ..:||....||::.|:|||.|.:|.|...||..:::.:.  .||..           ||   
  Rat    82 LN-LVLRGTLEHKLKWTFKIYDKDRNGCIDRLELLDIVEAIY--KLKKACRAELDLEQQGQLLTP 143

  Fly   130 QQIVDKTICFADKDEDGKISFDEF 153
            :::||:.....|::.||::|..||
  Rat   144 EEVVDRIFLLVDENGDGQLSLTEF 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 40/154 (26%)
Guca1bNP_001101668.1 FRQ1 15..175 CDD:227455 40/154 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.