DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and KCNIP3

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_038462.1 Gene:KCNIP3 / 30818 HGNCID:15523 Length:256 Species:Homo sapiens


Alignment Length:156 Identity:43/156 - (27%)
Similarity:82/156 - (52%) Gaps:21/156 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SNFDADEIRRLGKRFRKLDLDN---SGALSIDEFMSL-----PELQQNPLVQRVIDIFDADGNGE 69
            :.|...|::.|.:.|:     |   :|.:..|.|..:     |:.........:.:.|||||||.
Human    86 TKFTKKELQSLYRGFK-----NECPTGLVDEDTFKLIYAQFFPQGDATTYAHFLFNAFDADGNGA 145

  Fly    70 VDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKM---MVGNN----LKDT 127
            :.|::|:.|:| ..:||....||::||.:||::.||||:..|:..::|.   |:|.:    |::.
Human   146 IHFEDFVVGLS-ILLRGTVHEKLKWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRHTYPILRED 209

  Fly   128 QLQQIVDKTICFADKDEDGKISFDEF 153
            ...:.|::.....|:::||.::.:||
Human   210 APAEHVERFFEKMDRNQDGVVTIEEF 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 43/156 (28%)
KCNIP3NP_038462.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
FRQ1 81..245 CDD:227455 43/156 (28%)
EFh 130..192 CDD:238008 24/62 (39%)
EFh 166..238 CDD:238008 21/70 (30%)
Interaction with KCND2. /evidence=ECO:0000250 243..256
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.