DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and Cib2

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001015010.1 Gene:Cib2 / 300719 RGDID:1308718 Length:187 Species:Rattus norvegicus


Alignment Length:171 Identity:52/171 - (30%)
Similarity:84/171 - (49%) Gaps:20/171 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNE----TSLPMDM---CSNFDADEIRRLGKRFRKL-------DLDNSGALSIDEFMSL----P 47
            |||:    |...:|.   |:.|:..:|.:|..||.:|       |...|..:.:.  |||    |
  Rat     1 MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHARFYELAPNLVPMDYRKSPIVHVP--MSLIIQMP 63

  Fly    48 ELQQNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGEL 112
            ||::||..:|:::.|..||.|.:.|.:|:...|.......:..|..:||:|||.:.|.:|...:|
  Rat    64 ELRENPFKERIVEAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDL 128

  Fly   113 FQVLKMMVGNNLKDTQLQQIVDKTICFADKDEDGKISFDEF 153
            ...|..:..:.|.:.::..:.||.|..||.|.|||:.|.:|
  Rat   129 ELTLARLTKSELDEDEVVLVCDKVIEEADLDGDGKLGFADF 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 46/152 (30%)
Cib2NP_001015010.1 FRQ1 <68..178 CDD:227455 32/102 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.