DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and Cib3

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_006509731.1 Gene:Cib3 / 234421 MGIID:2685953 Length:187 Species:Mus musculus


Alignment Length:173 Identity:49/173 - (28%)
Similarity:86/173 - (49%) Gaps:16/173 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNETSL-------PMDMCSNFDADEIRRLGKRFR-------KLDLDNSGALSI--DEFMSLPEL 49
            |||:.::       ....|:.|...||.||..|::       .||...|..:.:  :...|:|||
Mouse     1 MGNKQTVFSHEQLEEYQDCTFFTRKEIMRLFYRYQDLAPQLVPLDYTTSPKVKVPYELIGSMPEL 65

  Fly    50 QQNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQ 114
            :.||..||:..:|..||:|.:..:.|:...|..|....:..|..:||:|||.:||.||...:|.|
Mouse    66 KDNPFRQRIAQVFSQDGDGHMTLENFLDMFSVMSEMAPRDLKAYYAFKIYDFNNDNYICAWDLEQ 130

  Fly   115 VLKMMVGNNLKDTQLQQIVDKTICFADKDEDGKISFDEFCSVV 157
            .:..:....|...::..:.:|.:..||.|:||::|.::|.:::
Mouse   131 TVTRLTRGELSAEEVTLVCEKVLDEADGDQDGRLSLEDFQNMI 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 44/149 (30%)
Cib3XP_006509731.1 FRQ1 6..178 CDD:227455 46/168 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.