DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and NCS1

DIOPT Version :10

Sequence 1:NP_524741.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_055101.2 Gene:NCS1 / 23413 HGNCID:3953 Length:190 Species:Homo sapiens


Alignment Length:151 Identity:51/151 - (33%)
Similarity:79/151 - (52%) Gaps:15/151 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FDADEIRRLGKRFRKLDLDNSGALSIDEFMSL-----PELQQNPLVQRVIDIFDADGNGEVDFKE 74
            |...|:::..|.|.| |.. ||.|....|..:     |..........|.::||.:.:|.::|.|
Human    22 FTEKEVQQWYKGFIK-DCP-SGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSE 84

  Fly    75 FIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQV---LKMMVGNNL----KDTQLQQI 132
            |||.:|..| ||....|||:||::||:||||||:..|:..:   :..||||.:    ::...::.
Human    85 FIQALSVTS-RGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVELPEEENTPEKR 148

  Fly   133 VDKTICFADKDEDGKISFDEF 153
            ||:.....||:.|||::..||
Human   149 VDRIFAMMDKNADGKLTLQEF 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_524741.1 FRQ1 20..157 CDD:444056 49/146 (34%)
NCS1NP_055101.2 FRQ1 22..174 CDD:444056 51/151 (34%)
Interaction with IL1RAPL1. /evidence=ECO:0000269|PubMed:12783849 174..190
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.