DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and cnb-1

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001256318.1 Gene:cnb-1 / 179572 WormBaseID:WBGene00000554 Length:171 Species:Caenorhabditis elegans


Alignment Length:169 Identity:134/169 - (79%)
Similarity:155/169 - (91%) Gaps:0/169 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNETSLPMDMCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDAD 65
            ||.:.||||:|||||||.|:|||.:||:|||:|.||:||::||||||||||||||||||||||.|
 Worm     1 MGADASLPMEMCSNFDAYELRRLTRRFKKLDVDGSGSLSVEEFMSLPELQQNPLVQRVIDIFDED 65

  Fly    66 GNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQLQ 130
            |||||||:|||||:|||||:|||.:||:|||||||||.||:||||||||||||||||||||:|||
 Worm    66 GNGEVDFREFIQGISQFSVKGDKNTKLKFAFRIYDMDRDGFISNGELFQVLKMMVGNNLKDSQLQ 130

  Fly   131 QIVDKTICFADKDEDGKISFDEFCSVVGNTDIHKKMVVD 169
            |||||||.|.|||.||||||.|||.||.:|::|||||::
 Worm   131 QIVDKTILFHDKDGDGKISFQEFCDVVEHTEVHKKMVLE 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 116/140 (83%)
cnb-1NP_001256318.1 FRQ1 13..161 CDD:227455 120/147 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159751
Domainoid 1 1.000 119 1.000 Domainoid score I3595
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68099
Inparanoid 1 1.050 282 1.000 Inparanoid score I1742
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 1 1.000 - - otm14651
orthoMCL 1 0.900 - - OOG6_101614
Panther 1 1.100 - - O PTHR45942
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R164
SonicParanoid 1 1.000 - - X1796
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.900

Return to query results.
Submit another query.