DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and chpf-1

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001379127.1 Gene:chpf-1 / 179415 WormBaseID:WBGene00014109 Length:195 Species:Caenorhabditis elegans


Alignment Length:191 Identity:75/191 - (39%)
Similarity:113/191 - (59%) Gaps:23/191 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNETSLPM------DMCS--NFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQR 57
            |||.:||.:      ::.|  .|:.::|.||..||..||....|.||.|:|:::|||..|||..|
 Worm     1 MGNSSSLMLRDEEIEEIMSETEFNRNQIVRLYSRFLSLDKKGQGFLSRDDFLNVPELAVNPLGDR 65

  Fly    58 VIDIFD--ADGNG-----EVDFKEFIQGVSQFS----VRGDKLS----KLRFAFRIYDMDNDGYI 107
            ::|.|.  |..||     :::|::|::.::.|.    |:.:.|:    ||.|||::||::.:.||
 Worm    66 IVDAFFTLASSNGDNEEQQLNFRQFVRILAHFQPISRVKKNALNSRKDKLLFAFKMYDLNKNDYI 130

  Fly   108 SNGELFQVLKMMVGNNLKDTQLQQIVDKTICFADKDEDGKISFDEFCSVVGNTDIHKKMVV 168
            :..|...:|..|||.|:...||.:|.|:||..||.|.||||||||||..:..|||.:||.:
 Worm   131 TREEFKVILNSMVGANITSDQLDKIADRTIEEADADRDGKISFDEFCRAMEKTDIEEKMSI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 63/157 (40%)
chpf-1NP_001379127.1 FRQ1 14..182 CDD:227455 65/167 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.