DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and pbo-1

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_497601.1 Gene:pbo-1 / 175385 WormBaseID:WBGene00003941 Length:196 Species:Caenorhabditis elegans


Alignment Length:190 Identity:67/190 - (35%)
Similarity:100/190 - (52%) Gaps:24/190 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MG-NETSLP------MDMCSNFDADEIRRLGKRFRKL-----DLDNSGALSIDEFMSLPELQQNP 53
            || |.:.:|      :.:.|......|.:|..||..|     ...|...|:..:|.|:.||:|||
 Worm     1 MGQNSSQIPEHELEHLSIESGLSRGGILKLYGRFISLATHRDKTTNEYFLTKGDFQSIAELKQNP 65

  Fly    54 LVQRVIDIFDADG----NGEVDFKEFIQGVSQF-SVRGDK-------LSKLRFAFRIYDMDNDGY 106
            |..|:||.|.||.    ..:|.||:|::.:|.| .:..:|       .:||||||.:||::..|.
 Worm    66 LGDRIIDAFFADAEVLERRKVYFKDFVKVLSHFRPINKNKPHPWNSREAKLRFAFTMYDLNKSGT 130

  Fly   107 ISNGELFQVLKMMVGNNLKDTQLQQIVDKTICFADKDEDGKISFDEFCSVVGNTDIHKKM 166
            |:..|...:|.||:|..:...|:..|.|:|:..||:|.||.|:|.|||:.:..|||.:||
 Worm   131 ITKDEFQDILAMMIGVGVPKDQVNSIADRTMREADRDGDGFITFQEFCNAMEKTDIEQKM 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 56/157 (36%)
pbo-1NP_497601.1 EFh 115..181 CDD:238008 29/65 (45%)
EF-hand_7 116..181 CDD:290234 28/64 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.