DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and CIB1

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_006720438.1 Gene:CIB1 / 10519 HGNCID:16920 Length:264 Species:Homo sapiens


Alignment Length:178 Identity:43/178 - (24%)
Similarity:87/178 - (48%) Gaps:19/178 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GNETSLPMDMCSNFD------ADEIRRLGKRF--------RKLDLDNSGALSIDEFMSLPELQQN 52
            |:.:.|..::.:.:.      ..||....:||        |.::......:..::.:|||||:.|
Human     3 GSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKAN 67

  Fly    53 PLVQRVIDIFD-ADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVL 116
            |..:|:..:|. :.....:.|::|:..:|.||.......|..:||||:|.|:||.::..:|.:::
Human    68 PFKERICRVFSTSPAKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLNREDLSRLV 132

  Fly   117 KMMVG----NNLKDTQLQQIVDKTICFADKDEDGKISFDEFCSVVGNT 160
            ..:.|    ..|..::::|::|..:..:|.|.||.|:..||..|:..:
Human   133 NCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 39/159 (25%)
CIB1XP_006720438.1 EF-hand_8 82..132 CDD:290545 15/49 (31%)
EF-hand_7 109..177 CDD:290234 20/67 (30%)
EFh 111..178 CDD:238008 21/66 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.