DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and kcnip3

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_002932578.2 Gene:kcnip3 / 100494097 -ID:- Length:284 Species:Xenopus tropicalis


Alignment Length:158 Identity:42/158 - (26%)
Similarity:79/158 - (50%) Gaps:24/158 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DEIRRLGKRFRKLDLDN----------SGALSIDEFMSL-----PELQQNPLVQRVIDIFDADGN 67
            |:::.:.| |.|.:|.:          ||.:..:.|..:     |:.........:.:.||.|.:
 Frog   108 DQLQAVTK-FTKKELQSLYRGFKNECPSGLVDEETFKLIYSQFFPQGDATMYAHFLFNAFDMDRS 171

  Fly    68 GEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKM---MVGNN----LK 125
            |.:.|::|:.|:| ..:||....||::||.:||::.||||:..|:..::|.   |:|..    |:
 Frog   172 GAIRFEDFVIGLS-ILLRGTIHEKLKWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRYTYPLLR 235

  Fly   126 DTQLQQIVDKTICFADKDEDGKISFDEF 153
            |....:.|::.....|::.||.::.|||
 Frog   236 DDAPIEHVERFFQKMDRNRDGVVTIDEF 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 42/158 (27%)
kcnip3XP_002932578.2 FRQ1 114..273 CDD:227455 41/152 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.