DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and si:ch211-103a14.5

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_002666176.1 Gene:si:ch211-103a14.5 / 100330921 ZFINID:ZDB-GENE-091204-414 Length:192 Species:Danio rerio


Alignment Length:161 Identity:41/161 - (25%)
Similarity:75/161 - (46%) Gaps:15/161 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNETSLPMDMCSNFDADEIRRLGKRFRKLDLD-NSGALSIDE---FMSLPELQQ--NPLVQRVI 59
            |||.....::..|..::.:      .:||...: .||.|:..|   |..|..|.:  |..|..:.
Zfish     1 MGNAPGTSVEELSACESHQ------WYRKFMTECPSGQLTFYEFKKFFGLKNLSEKSNEYVMTMF 59

  Fly    60 DIFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMM--VGN 122
            ..||.:.:|.:||.|::..:| ..::|....|||:.|::||:|..|.|...||..::|.:  :..
Zfish    60 QTFDMNDDGCIDFMEYVAALS-LILKGGVQQKLRWYFKLYDVDGSGCIDREELLLIVKAIRAING 123

  Fly   123 NLKDTQLQQIVDKTICFADKDEDGKISFDEF 153
            ..::...::..:......|.:.||.::.|||
Zfish   124 VEQEVSAEEFTNMVFEKIDLNADGVLTMDEF 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 38/149 (26%)
si:ch211-103a14.5XP_002666176.1 EF-hand_8 29..79 CDD:290545 15/49 (31%)
EF-hand_7 55..112 CDD:290234 19/57 (33%)
EFh 58..116 CDD:238008 19/58 (33%)
EFh 90..159 CDD:238008 18/65 (28%)
EF-hand_7 91..158 CDD:290234 17/64 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.