DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pie and Phf7

DIOPT Version :9

Sequence 1:NP_001260348.1 Gene:pie / 44315 FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_082225.1 Gene:Phf7 / 71838 MGIID:1919088 Length:307 Species:Mus musculus


Alignment Length:294 Identity:101/294 - (34%)
Similarity:155/294 - (52%) Gaps:26/294 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CLICKYSDTDDLVFGEWMIVRNLQVHYFCLLLSTHLPQRGGDSSGILGFLLRDIREEAAAAEKRK 73
            ||:|.....|....||::...||.||||||:||:.|||:|..:.|:.||:..||:.||..|.|:.
Mouse    33 CLLCLQEPGDPEKLGEFLQKDNLCVHYFCLILSSRLPQKGQPNRGLHGFMPEDIKREAVRASKKI 97

  Fly    74 CWYCNKIGASLQC--DRCRSLFHLKCGLENRAVFEFCGQYKSYCYKCRPMDDYKRQLQSNPPRNA 136
            |:.|.|.||:::|  |:|...|||.||.|...:.:|.|:|||||.|.||    .:.:........
Mouse    98 CFVCKKKGAAIRCQNDQCVQNFHLPCGQERGCLSQFFGEYKSYCRKHRP----TQNIHQGSLGEE 158

  Fly   137 TCPICFSSIYKVELHCVVYGDCCRLGFAHKKCMRQYALTSG-YYLRCIWCRS-ERFRDSIRLQSV 199
            :|.:|..::.:..:. .:...||.....|:||:::||.||. ::.:|..|.: |.|...:....:
Mouse   159 SCVLCCENLSRTSVE-NIQSPCCSQAIYHRKCIQKYAHTSAKHFFKCPQCNNREEFPQEMLRMGI 222

  Fly   200 FVPDRDATWEKQRNAYRELHERNLKCDQPNCLCPSGRT--YNRLSWVILCCSSCAATSAHLKCLV 262
            .:|||||.||.:..|:.||::|...||.|.||...||.  .:...|.::.|::|.:...|..|  
Mouse   223 HIPDRDAAWELEPGAFSELYQRYRHCDAPICLYEQGRDSFEDEGRWRLILCATCGSHGTHRDC-- 285

  Fly   263 GALRLPKKRERTDFKCSMCLDVERRIAEGPARTT 296
            .:||...|:    ::|:.||         ||.||
Mouse   286 SSLRPNSKK----WECNECL---------PASTT 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pieNP_001260348.1 PHD_SF 9..117 CDD:304600 50/109 (46%)
PHD_SF 224..>260 CDD:304600 11/37 (30%)
PARM 318..>491 CDD:293666
Phf7NP_082225.1 ePHD_PHF7_G2E3_like 33..144 CDD:277139 50/110 (45%)
PHD_PHF7_G2E3_like 247..300 CDD:276971 16/58 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831379
Domainoid 1 1.000 94 1.000 Domainoid score I7456
eggNOG 1 0.900 - - E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6144
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110264at33208
OrthoFinder 1 1.000 - - FOG0003998
OrthoInspector 1 1.000 - - otm43314
orthoMCL 1 0.900 - - OOG6_106451
Panther 1 1.100 - - O PTHR12420
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3283
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.700

Return to query results.
Submit another query.