DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pie and Phf11c

DIOPT Version :9

Sequence 1:NP_001260348.1 Gene:pie / 44315 FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001157761.1 Gene:Phf11c / 628705 MGIID:3648476 Length:339 Species:Mus musculus


Alignment Length:292 Identity:57/292 - (19%)
Similarity:94/292 - (32%) Gaps:81/292 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EDNKELQCLICKYSDTDDLVFGEWMIV-----RNLQVHYFCLLLSTHLPQ----------RGGDS 51
            |..::..|.:|....       :|.::     .|:..|..|||.|:.|.:          |..|.
Mouse    41 EKMEKRTCALCPEGH-------DWSVIYFVPSANIAAHENCLLYSSGLVECEAHNPCKIARNVDV 98

  Fly    52 SGILGFLLRDIREEAAAAEKRKCWYCNKIGASLQCDR--CRSLFHLKCGLENRAVFE--FCGQYK 112
            ..:|        |.........|.:||..||.::|..  |...:||.|..|:.||.:  ....||
Mouse    99 KSVL--------ERIWRGSTMICSFCNNEGAIVRCGETSCAKNYHLFCAKEDYAVLQGGVTRTYK 155

  Fly   113 SYCYKCRPMDD----------------YKRQLQSNPPRNATCPICFSSIYKVELHCVVYGDCCRL 161
            .:|.:..|..:                .|::|.|.||..........|...|....:.:.|....
Mouse   156 LFCPEHPPQQEEATESADGPSMKRKRGRKKRLSSGPPAQPKVVKFMRSKRHVTGEPLGHRDAAVK 220

  Fly   162 GFAHKKCMR--------QYALTSGYYLRCIWCR------SER--------------FRDSIRLQS 198
            ....|||.:        :|.|..   :..|:.|      ||.              |:|::|...
Mouse   221 APFLKKCKKAGLLNVLLEYILEK---MNSIYGRLLDETASESDYEGIETLLFGCGLFKDTLRKFQ 282

  Fly   199 VFVPDRDATWEKQRNAYRELHERNLKCDQPNC 230
            ..:..:...||:::...::..|......|..|
Mouse   283 EVIKSKACEWEERQRLMKQQLEALADLQQSLC 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pieNP_001260348.1 PHD_SF 9..117 CDD:304600 30/126 (24%)
PHD_SF 224..>260 CDD:304600 2/7 (29%)
PARM 318..>491 CDD:293666
Phf11cNP_001157761.1 PHD_SF 48..161 CDD:304600 30/127 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12420
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.