DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pie and si:ch211-37e10.1

DIOPT Version :9

Sequence 1:NP_001260348.1 Gene:pie / 44315 FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_017209386.2 Gene:si:ch211-37e10.1 / 567550 ZFINID:ZDB-GENE-131127-547 Length:661 Species:Danio rerio


Alignment Length:257 Identity:55/257 - (21%)
Similarity:80/257 - (31%) Gaps:79/257 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 ALRLPKKRERTDFKCSMCLDVERR---IAEGPARTTEETNADG----DNQVDGSF---------Y 312
            :||..::::|...:.|..  .|||   |.|...||.||. |||    ....||:.         .
Zfish    63 SLRADQEKDRRTEEISQY--EERRLKIIQERLMRTNEEP-ADGIPLKFTFPDGTMKIRRFQVFDQ 124

  Fly   313 VQKLGPDAATRSLTQTPVFSEEDESERSSNITV---------------------------IFSQP 350
            :|.|.....|.|......:.:|..|..|.:.||                           :|.|.
Zfish   125 IQALFDFVGTHSSATEYFYIKEATSAVSISSTVPGTLLDHYLNAPLNIHVRWMEMEDVQALFHQQ 189

  Fly   351 KSNATSERLSLSPPQEEMIVEIPDSPEASPKTSIDENHSPQPIARRDTSDSPQPIA-----ASEI 410
            .|      :.|..|.|....|:.|..|.....:.||.||...:...|:....:..:     .||.
Zfish   190 NS------VLLPSPDELETSEVQDDLETVESVTPDEIHSQDDMEIMDSGSREEMYSNHRENVSET 248

  Fly   411 PDSPQPTAASEIPDLPQTTAINVNPELTQQTALNTIP------HSPQPEASFSTQLVSQTFD 466
            .||.        |:: .....|:.|:       |.:|      |....|..:....|..|.|
Zfish   249 VDSG--------PEI-YNNYNNIMPD-------NDLPEPDDQDHQDGSEVMYLEDFVGSTED 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pieNP_001260348.1 PHD_SF 9..117 CDD:304600
PHD_SF 224..>260 CDD:304600
PARM 318..>491 CDD:293666 35/187 (19%)
si:ch211-37e10.1XP_017209386.2 UBQ 105..>142 CDD:320785 6/36 (17%)
HECTc 309..659 CDD:331829
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12420
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.