DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pie and G2E3

DIOPT Version :9

Sequence 1:NP_001260348.1 Gene:pie / 44315 FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_060239.2 Gene:G2E3 / 55632 HGNCID:20338 Length:706 Species:Homo sapiens


Alignment Length:296 Identity:97/296 - (32%)
Similarity:156/296 - (52%) Gaps:35/296 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DNKELQCLICKYSDTDDLVFGE------WMIVRNLQVHYFCLLLSTHLPQRGGDSSGILGFLLRD 61
            |::.|.|:.|:..|.....:||      |    ||.|||:|||:|:.:.|||.:..|:.|||:.|
Human     8 DSQNLACVFCRKHDDCPNKYGEKKTKEKW----NLTVHYYCLLMSSGIWQRGKEEEGVYGFLIED 68

  Fly    62 IREEAAAAEKRKCWYCNKIGASLQC--DRCRSLFHLKCGLENRAVFEFCGQYKSYCYKCRPM--- 121
            ||:|...|.|.||..|.|.|||:.|  .||:..:|..|||:...:|:|.|.:.|:|:..||:   
Human    69 IRKEVNRASKLKCCVCKKNGASIGCVAPRCKRSYHFPCGLQRECIFQFTGNFASFCWDHRPVQII 133

  Fly   122 --DDYKRQLQSNPPRNATCPICFSSIYKVELHCVVYGDCCRLGFAHKKCMRQYALTSG-YYLRCI 183
              ::|:..|        .|.||...|..:..:.::...||:..:.|:.|::..|:.:| ::.||.
Human   134 TSNNYRESL--------PCTICLEFIEPIPSYNILRSPCCKNAWFHRDCLQVQAINAGVFFFRCT 190

  Fly   184 WC-RSERFRDSIRLQSVFVPDRDATWEKQRNAYRELHERNLKCDQPNCLCPSGRTYNR--LSWVI 245
            .| .|:.|:..:....:.:|::||:||.:.|||:||.:...:||...|.|..||.||.  ..|.|
Human   191 ICNNSDIFQKEMLRMGIHIPEKDASWELEENAYQELLQHYERCDVRRCRCKEGRDYNAPDSKWEI 255

  Fly   246 LCCSSCAATSAHLKCLVGALRLPKKRERTDFKCSMC 281
            ..|..|.::..||.|  .:||..::    :::|..|
Human   256 KRCQCCGSSGTHLAC--SSLRSWEQ----NWECLEC 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pieNP_001260348.1 PHD_SF 9..117 CDD:304600 47/115 (41%)
PHD_SF 224..>260 CDD:304600 14/37 (38%)
PARM 318..>491 CDD:293666
G2E3NP_060239.2 ePHD_PHF7_G2E3_like 14..127 CDD:277139 47/116 (41%)
PHD_PHF7_G2E3_like 232..285 CDD:276971 18/58 (31%)
HECTc 411..692 CDD:331829
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141433
Domainoid 1 1.000 93 1.000 Domainoid score I7551
eggNOG 1 0.900 - - E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110264at33208
OrthoFinder 1 1.000 - - FOG0003998
OrthoInspector 1 1.000 - - otm41254
orthoMCL 1 0.900 - - OOG6_106451
Panther 1 1.100 - - O PTHR12420
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3283
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.750

Return to query results.
Submit another query.