DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pie and PHF11

DIOPT Version :9

Sequence 1:NP_001260348.1 Gene:pie / 44315 FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001035533.1 Gene:PHF11 / 51131 HGNCID:17024 Length:331 Species:Homo sapiens


Alignment Length:171 Identity:40/171 - (23%)
Similarity:63/171 - (36%) Gaps:45/171 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EDNKELQCLIC-KYSDTDDLVFGEWMIVRNLQVHYFCLLLSTHL----------PQRGGDSSGIL 55
            |..::..|.:| |..:.:.|.|.:   ..|:..|..|||.|:.|          |.|..|     
Human    38 EKMEKRTCALCPKDVEYNVLYFAQ---SENIAAHENCLLYSSGLVECEDQDPLNPDRSFD----- 94

  Fly    56 GFLLRDIREEAAAAEKRKCWYCNKIGASLQCD--RCRSLFHLKCGLENRAVFEFCGQYKSYCYKC 118
               :..:::|.....|.||.:|:|.||::.||  .|...:|..|..::.||.:..|....|...|
Human    95 ---VESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQSDGVRGIYKLLC 156

  Fly   119 RPMDDY------------------KRQLQSN---PPRNATC 138
            :....:                  |:.|..|   ||....|
Human   157 QQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPPETMKC 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pieNP_001260348.1 PHD_SF 9..117 CDD:304600 32/120 (27%)
PHD_SF 224..>260 CDD:304600
PARM 318..>491 CDD:293666
PHF11NP_001035533.1 ePHD_PHF11 45..159 CDD:277182 33/124 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12420
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.