DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pie and Nedd4

DIOPT Version :9

Sequence 1:NP_001260348.1 Gene:pie / 44315 FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster


Alignment Length:434 Identity:79/434 - (18%)
Similarity:135/434 - (31%) Gaps:159/434 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 ATWEKQRNAYRELHERNLKCDQPNCLCPSGRTY------NRLSW---VILCCSSCAATSAHLKCL 261
            |.||::::|                   :||||      ....|   .:|...|..:|...|   
  Fly   250 AGWEERQDA-------------------NGRTYYVNHTARTTQWDRPTVLNSHSSQSTDDQL--- 292

  Fly   262 VGALRLPKKRERTDFKCSMCLDVERRIAEGPARTTEETNADGDNQVDGSFYVQKLGPDAATRSL- 325
                       .:||:....:.|:...:...|.:....:.:.:|...|..|..|   .|||.|. 
  Fly   293 -----------ASDFQRRFHISVDDTESGRSADSISHNSIEDNNNAAGLAYTPK---TAATSSAP 343

  Fly   326 TQTPV-------------FSEEDESERSSNITVIFS---------QPKSNATSERLSLSPPQEEM 368
            ..||.             .:|||:.....:.:.:::         ||:.:|||.:..|.|.:|  
  Fly   344 PNTPTNNNGILAQIAMQYRAEEDQDPTVDHTSFVYNSLRHPVAHRQPEISATSLQNDLRPVRE-- 406

  Fly   369 IVEIPDSPEASPKTS-----------------------------------------IDENH---S 389
            ...:||....:|.|.                                         :|.:|   .
  Fly   407 APGVPDIAITNPFTRRAAGNMAGGAGWQQERRRQQMQLHIQQHQQRQQQQQQNRILLDVDHRQQE 471

  Fly   390 PQPIARR------------DTSDSPQP---IAASEIPDSPQPTAASEIPDLPQTTAINVNPELTQ 439
            ||...:|            |.:||..|   .|.|...:|.:..||  :|.:.|.|.....| |..
  Fly   472 PQHRGQRHQQQHRPSNEDTDHTDSHNPSDISAPSTRRNSEEDNAA--VPPMEQNTGGEEEP-LPP 533

  Fly   440 QTALNTIPHSPQPEASFSTQLVSQTFDCPQPQEQAVAKAPNSPSLPKEDPNTLLVLKSGFQ---- 500
            :.::...|:.    .:|.....|:......|:....:..||.....::|   |..|..|::    
  Fly   534 RWSMQVAPNG----RTFFIDHASRRTTWIDPRNGRASPMPNQTRRVEDD---LGPLPEGWEERVH 591

  Fly   501 CPGEPFFYLVIYEFEHGTCMGECIGTCVLRFKEDDPRIQDTSQA 544
            ..|..|:      .:|.|...:.          :|||:.:.:.|
  Fly   592 TDGRVFY------IDHNTRTTQW----------EDPRLSNPNIA 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pieNP_001260348.1 PHD_SF 9..117 CDD:304600
PHD_SF 224..>260 CDD:304600 9/44 (20%)
PARM 318..>491 CDD:293666 47/254 (19%)
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809 9/45 (20%)
WW 531..560 CDD:278809 4/32 (13%)
WW 581..613 CDD:197736 8/47 (17%)
HECTc 650..1003 CDD:238033
HECTc 674..1003 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.