DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pie and Phf11d

DIOPT Version :9

Sequence 1:NP_001260348.1 Gene:pie / 44315 FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_950180.3 Gene:Phf11d / 219132 MGIID:1277133 Length:320 Species:Mus musculus


Alignment Length:289 Identity:57/289 - (19%)
Similarity:105/289 - (36%) Gaps:72/289 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDNKELQCLICKYSDTDDLVFGEWMIV-----RNLQVHYFCLLLSTHLPQ------RGGDSSGI 54
            :|..::..|.:|....       ||..:     .|:..|..|||.|:.|.:      |    :.|
Mouse    20 IEKMEKRTCALCPEGH-------EWSQIYFSPSGNIVAHENCLLYSSGLVECETLDLR----NTI 73

  Fly    55 LGFLLRDIREEAAAAEKRKCWYCNKIGASLQCDR--CRSLFHLKCGLENRAVFEFCGQ---YKSY 114
            ..|.::.:::|.....:.||.:|||.||::.||.  |:..:|..|..:::|:.:..|.   ||.:
Mouse    74 RNFDVKSVKKEIWRGRRLKCSFCNKGGATVGCDLWFCKKSYHYVCAKKDQAILQVDGNHGTYKLF 138

  Fly   115 CYKCRP--------MDD--------YKRQLQSNPPRNATCPICFSSIYKVELHCVVYG------- 156
            |.:..|        .||        ..::|.|.||.......|.::  |..:....:|       
Mouse   139 CPEHSPEQEEATESADDPSMKKKRGKNKRLSSGPPAQPKTMKCSNA--KRHMTEEPHGHTDAAVK 201

  Fly   157 -----DCCRLGF--------------AHKKCMRQYALTSGYY-LRCIWCRSERFRDSIRLQSVFV 201
                 .|...|.              .|.:.:.:.|..|.|. :..:......|:|::|.....:
Mouse   202 SPFLKKCQEAGLLTELFEHILENMDSVHGRLVDETASESDYEGIETLLFDCGLFKDTLRKFQEVI 266

  Fly   202 PDRDATWEKQRNAYRELHERNLKCDQPNC 230
            ..:...||:::...::..|......|..|
Mouse   267 KSKACEWEERQRQMKQQLEALADLQQSLC 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pieNP_001260348.1 PHD_SF 9..117 CDD:304600 32/123 (26%)
PHD_SF 224..>260 CDD:304600 2/7 (29%)
PARM 318..>491 CDD:293666
Phf11dNP_950180.3 PHD_SF 28..142 CDD:304600 32/124 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..196 9/52 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12420
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.