DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pie and Tcf20

DIOPT Version :9

Sequence 1:NP_001260348.1 Gene:pie / 44315 FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001107612.1 Gene:Tcf20 / 21411 MGIID:108399 Length:1987 Species:Mus musculus


Alignment Length:412 Identity:83/412 - (20%)
Similarity:127/412 - (30%) Gaps:163/412 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 PDRDATWEKQRNAYREL-HERNLKC--------DQPNCLCPSGRTYNRLSWVILCCSSCAATS-- 255
            |.::.. :|..|:|..| |.:::|.        |.||   |..|.          |.:...||  
Mouse  1315 PSKEGA-DKAYNSYSHLSHSQDIKSIPKRDSSKDLPN---PDNRN----------CPAVTLTSPA 1365

  Fly   256 ------------AHLKCLVGALRLPKKR------------------------------------- 271
                        ..|:.:|..:..|..|                                     
Mouse  1366 KTKILPPRKGRGLKLEAIVQKITSPNIRRSASANSAEAGGDTVTLDDILSLKSGPPEGGTVATQE 1430

  Fly   272 -ERTDFKCSMCLD----------VERRIAEGPARTTEETNADGDNQVDGSFYVQKLGPDAATRSL 325
             |....||.:..|          ||:.: .||   :||....||::|....:|:       |.|.
Mouse  1431 AEMEKRKCEVVSDLVSVTNQESNVEKPL-PGP---SEEWRGSGDDKVKTEAHVE-------TAST 1484

  Fly   326 TQTPVFSEEDESERSSNITVIFSQ-PKSNATSERLSL--SPPQEEMIVEIPDS----------PE 377
            .:.|          |..:|...|| |..|......||  :.|     :..|||          ||
Mouse  1485 GKEP----------SGTMTSTASQKPGGNQGRPDGSLGGAAP-----LIFPDSKNVAPVGILAPE 1534

  Fly   378 ASPKTSIDENHSPQPIARRDTSDSP-----------QPIAA--------SEIPDSPQPTAASEIP 423
            |:||....||.:.. |:.:..|..|           :||.:        .:.|..|||      |
Mouse  1535 ANPKAEEKENDTVM-ISPKQESFPPKGYFPSGKKKGRPIGSVNKQKKQQQQPPPPPQP------P 1592

  Fly   424 DLPQTTAINVNPELTQQTALNTIPHSPQPEASFSTQLVSQTFDCPQPQEQAVAKAPNSPSLPKED 488
            .:|:.:| :..|:..:|....   ...:|.|....:...|.....:|||..:.....:..|.|.|
Mouse  1593 QMPEGSA-DGEPKPKKQRQRR---ERRKPGAQPRKRKTKQAVPIVEPQEPEIKLKYATQPLDKTD 1653

  Fly   489 PNTLLVLKSGFQCPGEPFFYLV 510
            ...    ||.|     |:.::|
Mouse  1654 AKN----KSFF-----PYIHVV 1666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pieNP_001260348.1 PHD_SF 9..117 CDD:304600
PHD_SF 224..>260 CDD:304600 10/57 (18%)
PARM 318..>491 CDD:293666 45/204 (22%)
Tcf20NP_001107612.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..79
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..432
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 446..481
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 502..816
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 844..891
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 949..1065
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1136..1372 15/70 (21%)
Leucine-zipper 1198..1219
Nuclear localization signal 1282..1295
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1415..1434 1/18 (6%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1446..1636 49/226 (22%)
Nuclear localization signal 1604..1628 3/26 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1685..1710
ePHD_TCF20 1733..1959 CDD:277169
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1760..1865
Nuclear localization signal 1812..1819
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1966..1987
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.