DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pie and RAI1

DIOPT Version :9

Sequence 1:NP_001260348.1 Gene:pie / 44315 FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_016879514.1 Gene:RAI1 / 10743 HGNCID:9834 Length:1967 Species:Homo sapiens


Alignment Length:388 Identity:80/388 - (20%)
Similarity:125/388 - (32%) Gaps:144/388 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 IAEGPARTTEETNADGD-------------------NQVDGSFYVQKLGPDAATRSLTQTPVFSE 333
            ::|.|:.|.:.|:|:..                   ||..||.........|...|::...|.|.
Human   497 LSEPPSSTPQSTHAEPQEADYLSGSEDPLERSFLYCNQARGSPARVNSNSKAKPESVSTCSVTSP 561

  Fly   334 EDESERSSNI--TVIFSQPKSNATS--------ERLSLSP-PQEEMIVEIPDSPEA--------- 378
            :|.|.:|.:.  ::..|.|..:.:.        .||.||. .||::..||....||         
Human   562 DDMSTKSDDSFQSLHGSLPLDSFSKFVAGERDCPRLLLSALAQEDLASEILGLQEAIGEKADKAW 626

  Fly   379 -----------SPKTSIDENHSP--QPIARRDTSDSPQPIAASEIPDSPQ--------------- 415
                       .|..|: ||||.  ..:|:   |..|:|.....:|||.|               
Human   627 AEAPSLVKDSSKPPFSL-ENHSACLDSVAK---SAWPRPGEPEALPDSLQLDKGGNAKDFSPGLF 687

  Fly   416 --PTAASEIPDLPQTT---AINVNPELTQQTALNTIPHSPQPEASFSTQLVSQTFDC-PQPQEQA 474
              |:.|...||..:||   :....|.|       .:| :|.|        .:..||| |.....:
Human   688 EDPSVAFATPDPKKTTGPLSFGTKPTL-------GVP-APDP--------TTAAFDCFPDTTAAS 736

  Fly   475 VAKAPNSPSLPKEDPNTLLVLKSGFQC------PGEPFFYLVIYEFEHGTCMGECI-------GT 526
            .|.:.|..:.|:|:        .|..|      |||     :....|.|....:.|       .:
Human   737 SADSANPFAWPEEN--------LGDACPRWGLHPGE-----LTKGLEQGGKASDGISKGDTHEAS 788

  Fly   527 CVLRFKEDDP------------------RIQDTSQAALERVNITPDDVW-------CRSEDRG 564
            ..|.|:|:||                  .:::.:...|:...:...|.|       |.:.|.|
Human   789 ACLGFQEEDPPGEKVASLPGDFKQEEVGGVKEEAGGLLQCPEVAKADRWLEDSRHCCSTADFG 851

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pieNP_001260348.1 PHD_SF 9..117 CDD:304600
PHD_SF 224..>260 CDD:304600
PARM 318..>491 CDD:293666 52/226 (23%)
RAI1XP_016879514.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.