DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pie and si:ch211-57f7.7

DIOPT Version :9

Sequence 1:NP_001260348.1 Gene:pie / 44315 FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_021336444.1 Gene:si:ch211-57f7.7 / 101883039 ZFINID:ZDB-GENE-090313-119 Length:382 Species:Danio rerio


Alignment Length:227 Identity:51/227 - (22%)
Similarity:80/227 - (35%) Gaps:57/227 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 VILCCSSCAATSAHLKCLVGA---LRLPKKRERTDFKCSMCLDVER--RIAEGPARTTEETNADG 303
            :.:.||        |:.|:|.   |..|:..|..:....:.|.|.|  .:...|:|....|..|.
Zfish     2 IFILCS--------LEILMGCGNKLIKPQLTEGQELDGRIILKVFRLKALYVRPSRPLLLTETDC 58

  Fly   304 DNQVDGSFYVQKLGPDAATRSLTQTP----------VFSEEDESERSSNITVIFSQPKSNATSER 358
            .:  |..|.|     |....|:.|:|          .|:::..::.||:..|    ..|..|...
Zfish    59 SD--DSCFEV-----DMPGESIHQSPGTASDENMNTDFNDQSSTQNSSSTRV----QSSTRTQFS 112

  Fly   359 LSLSPPQEEMIVEIPDSPEASPKTSIDENHSPQPIARRDTSDSPQPIAASEIPDSPQPTAASEIP 423
            .|.|..|..     ..|.:..|.||..   ..||..   :|.|..|..:|.  .:...|::|.:|
Zfish   113 TSFSSAQPS-----TSSSDTQPFTSFS---GVQPFT---SSSSVLPSTSSS--GTQASTSSSSLP 164

  Fly   424 DLPQTTAINVNPELTQQTALNTIPHSPQPEAS 455
              |.|.:..:.|        :|:....||..|
Zfish   165 --PSTNSRGLQP--------STLSSGAQPSTS 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pieNP_001260348.1 PHD_SF 9..117 CDD:304600
PHD_SF 224..>260 CDD:304600 3/15 (20%)
PARM 318..>491 CDD:293666 33/148 (22%)
si:ch211-57f7.7XP_021336444.1 HECTc 273..>344 CDD:331829
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12420
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.