DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pie and Phf6

DIOPT Version :9

Sequence 1:NP_001260348.1 Gene:pie / 44315 FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_008771882.1 Gene:Phf6 / 100359714 RGDID:2323526 Length:364 Species:Rattus norvegicus


Alignment Length:307 Identity:68/307 - (22%)
Similarity:117/307 - (38%) Gaps:66/307 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KELQCLICKYSDTDDLVFGEWMIVRNLQV--HYFCLLLSTHLPQRGGDSSGILGFLLRDIREEAA 67
            ::.:|..||  ...|...|:.:|..|.:|  |:.|:|.|:.|.....|:..:.||.:.|:::|..
  Rat    13 RQRKCGFCK--SNRDKECGQLLISENQKVAAHHKCMLFSSALVSSHSDNESLGGFSIEDVQKEIK 75

  Fly    68 AAEKRKCWYCNKIGASLQCD--RCRSLFHLKCGLENRAVFE---FCGQYKSYCYKCRPMDDYKRQ 127
            ...|..|..|:..||::.||  .|...:|..|.|.::|...   ..|.|..||.|      :|:.
  Rat    76 RGTKLMCSLCHCPGATIGCDVKTCHRTYHYHCALHDKAQIREKPSQGIYMVYCRK------HKKT 134

  Fly   128 LQSNPPRNATCPICFSSIYKVELHCVVYGDCCRLGFAHKKCMRQYALTSGYYLRCIWCRSERFRD 192
            ..::   .|.....|:. :::|..........|.|...|..::..|              |..|.
  Rat   135 AHNS---EADLEESFNE-HELEPSSPKTKKKSRKGRPRKTNLKGLA--------------EDTRS 181

  Fly   193 SIRLQSVFVPDRDATWEKQRNAYREL--HERNLKCDQPNC-LCPSGRTYNRLSWVILCCSSCAAT 254
            :         ....|.|.:.::||:.  |..:....:|.| .|..|...|.....:...::..| 
  Rat   182 T---------SSHGTDETESSSYRDRSPHRSSPNDTRPKCGFCHVGEEENEARGKLHIFNAKKA- 236

  Fly   255 SAHLKCLV---GALRL--PKKRERTDF---------------KCSMC 281
            :||.||::   |.::|  ..:.|..||               ||::|
  Rat   237 AAHYKCMLFSSGTVQLTTTSRAEFGDFDIKTVLQEIKRGKRMKCTLC 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pieNP_001260348.1 PHD_SF 9..117 CDD:304600 34/114 (30%)
PHD_SF 224..>260 CDD:304600 8/36 (22%)
PARM 318..>491 CDD:293666
Phf6XP_008771882.1 ePHD1_PHF6 17..131 CDD:277180 35/121 (29%)
ePHD2_PHF6 212..329 CDD:277181 17/73 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12420
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.