DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-1 and VMA3

DIOPT Version :9

Sequence 1:NP_476801.1 Gene:Vha16-1 / 44307 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_010887.3 Gene:VMA3 / 856686 SGDID:S000000753 Length:160 Species:Saccharomyces cerevisiae


Alignment Length:150 Identity:110/150 - (73%)
Similarity:131/150 - (87%) Gaps:2/150 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVV 74
            |:|.||||.:|.||||||::|||||||||||.||.|..|:||:|:.|:|:||:||||||||||||
Yeast     6 PVYAPFFGAIGCASAIIFTSLGAAYGTAKSGVGICATCVLRPDLLFKNIVPVIMAGIIAIYGLVV 70

  Fly    75 AVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILIL 139
            :||:..:|.:  |.:||.|||.|||||:||.|||||||||||||||||||::|||||||||||||
Yeast    71 SVLVCYSLGQ--KQALYTGFIQLGAGLSVGLSGLAAGFAIGIVGDAGVRGSSQQPRLFVGMILIL 133

  Fly   140 IFAEVLGLYGLIVAIYLYTK 159
            ||||||||||||||:.|.::
Yeast   134 IFAEVLGLYGLIVALLLNSR 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 V_ATP_synt_C 15..122 CDD:130170 75/106 (71%)
ATP-synt_Vo_c_ATP6C_rpt2 90..157 CDD:349416 58/66 (88%)
VMA3NP_010887.3 V_ATP_synt_C 11..116 CDD:130170 75/106 (71%)
ATP-synt_Vo_c_ATP6C_rpt2 84..151 CDD:349416 58/66 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342241
Domainoid 1 1.000 106 1.000 Domainoid score I1449
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68199
Inparanoid 1 1.050 217 1.000 Inparanoid score I785
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53914
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - otm46554
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - LDO PTHR10263
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1636
SonicParanoid 1 1.000 - - X666
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.