DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-1 and OLI1

DIOPT Version :9

Sequence 1:NP_476801.1 Gene:Vha16-1 / 44307 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_009319.1 Gene:OLI1 / 854584 SGDID:S000007274 Length:76 Species:Saccharomyces cerevisiae


Alignment Length:66 Identity:22/66 - (33%)
Similarity:35/66 - (53%) Gaps:7/66 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 HLGAGLA-VGFSGLAAGFAIGIVGDAGVRGTAQQPRL----FVGMILILIFAEVLGLYGLIVAIY 155
            ::|||:: :|.  |.||..|.||..|.:.|.::.|.:    |...||....:|..||:.|:|:..
Yeast     9 YIGAGISTIGL--LGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLFCLMVSFL 71

  Fly   156 L 156
            |
Yeast    72 L 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 V_ATP_synt_C 15..122 CDD:130170 11/26 (42%)
ATP-synt_Vo_c_ATP6C_rpt2 90..157 CDD:349416 22/66 (33%)
OLI1NP_009319.1 ATP-synt_Fo_c_ATP5G3 8..72 CDD:349422 21/64 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.