DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-1 and VHA-C3

DIOPT Version :9

Sequence 1:NP_476801.1 Gene:Vha16-1 / 44307 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_195603.1 Gene:VHA-C3 / 830047 AraportID:AT4G38920 Length:164 Species:Arabidopsis thaliana


Alignment Length:158 Identity:100/158 - (63%)
Similarity:125/158 - (79%) Gaps:3/158 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SEVSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGII 67
            |..|.|..  .||||.:|||:|::||.:||||||||||.|:|:|.||||||:||||:||||||::
plant     2 STFSGDET--APFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVL 64

  Fly    68 AIYGLVVAVLIAGALEEPSK-YSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRL 131
            .||||::||:|:..:...:| |.|:.|:.||.:|||.|.:||:||.|||||||||||..||||:|
plant    65 GIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKL 129

  Fly   132 FVGMILILIFAEVLGLYGLIVAIYLYTK 159
            ||||||||||||.|.||||||.|.|.::
plant   130 FVGMILILIFAEALALYGLIVGIILSSR 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 V_ATP_synt_C 15..122 CDD:130170 67/107 (63%)
ATP-synt_Vo_c_ATP6C_rpt2 90..157 CDD:349416 48/66 (73%)
VHA-C3NP_195603.1 V_ATP_synt_C 12..120 CDD:130170 67/107 (63%)
ATP-synt_Vo_c_ATP6C_rpt2 88..155 CDD:349416 48/66 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 96 1.000 Domainoid score I2452
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I1314
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - mtm8409
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - LDO PTHR10263
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X666
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.