DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-1 and ATP6V0C

DIOPT Version :9

Sequence 1:NP_476801.1 Gene:Vha16-1 / 44307 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001185498.1 Gene:ATP6V0C / 527 HGNCID:855 Length:155 Species:Homo sapiens


Alignment Length:154 Identity:125/154 - (81%)
Similarity:135/154 - (87%) Gaps:2/154 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIY 70
            |...|.|..||.||||::|::||||||||||||||||||||||||||.|||||||||||||||||
Human     4 SKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIY 68

  Fly    71 GLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGM 135
            |||||||||.:|.:  ..|||:.|:.|||||:||.||||||||||||||||||||||||||||||
Human    69 GLVVAVLIANSLND--DISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGM 131

  Fly   136 ILILIFAEVLGLYGLIVAIYLYTK 159
            ||||||||||||||||||:.|.||
Human   132 ILILIFAEVLGLYGLIVALILSTK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 V_ATP_synt_C 15..122 CDD:130170 86/106 (81%)
ATP-synt_Vo_c_ATP6C_rpt2 90..157 CDD:349416 58/66 (88%)
ATP6V0CNP_001185498.1 V_ATP_synt_C 13..118 CDD:130170 86/106 (81%)
ATP-synt_Vo_c_ATP6C_rpt2 86..153 CDD:349416 58/66 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143869
Domainoid 1 1.000 109 1.000 Domainoid score I6366
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68199
Inparanoid 1 1.050 233 1.000 Inparanoid score I3429
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - otm40490
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - LDO PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.