DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-1 and atp6v0c

DIOPT Version :9

Sequence 1:NP_476801.1 Gene:Vha16-1 / 44307 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_988893.1 Gene:atp6v0c / 394488 XenbaseID:XB-GENE-981790 Length:156 Species:Xenopus tropicalis


Alignment Length:159 Identity:129/159 - (81%)
Similarity:141/159 - (88%) Gaps:3/159 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSEVSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAG 65
            ||::.:| .|.|..||.||||:||::|||||||||||||||||||||||||||||||||||||||
 Frog     1 MSTDTAS-APEYSAFFAVMGASSAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAG 64

  Fly    66 IIAIYGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPR 130
            ||||||||||||||.:|  .|..:||:.|:.|||||:||.|||||||||||||||||||||||||
 Frog    65 IIAIYGLVVAVLIANSL--TSSITLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPR 127

  Fly   131 LFVGMILILIFAEVLGLYGLIVAIYLYTK 159
            |||||||||||||||||||||||:.|.||
 Frog   128 LFVGMILILIFAEVLGLYGLIVALILSTK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 V_ATP_synt_C 15..122 CDD:130170 88/106 (83%)
ATP-synt_Vo_c_ATP6C_rpt2 90..157 CDD:349416 58/66 (88%)
atp6v0cNP_988893.1 V_ATP_synt_C 14..119 CDD:130170 88/106 (83%)
ATP-synt_Vo_c_ATP6C_rpt2 87..154 CDD:349416 58/66 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68199
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10263
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1636
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.140

Return to query results.
Submit another query.