DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-1 and Vha16-2

DIOPT Version :9

Sequence 1:NP_476801.1 Gene:Vha16-1 / 44307 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_729707.1 Gene:Vha16-2 / 39282 FlyBaseID:FBgn0028668 Length:158 Species:Drosophila melanogaster


Alignment Length:159 Identity:109/159 - (68%)
Similarity:129/159 - (81%) Gaps:2/159 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSEVSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAG 65
            |.:...::.|.|..|.|..|||.||||:.|||:||||.||.|||.|:|.||::|||:||||||||
  Fly     1 MVTAALNEEPSYAFFLGCTGAAVAIIFTTLGASYGTAVSGVGIAKMAVNRPDMIMKAIIPVVMAG 65

  Fly    66 IIAIYGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPR 130
            |||||||||:|||||::.:  .|::...::||||||:||..||.||.||||.|||||||||:|||
  Fly    66 IIAIYGLVVSVLIAGSIGD--DYTMEDSYVHLGAGLSVGLPGLTAGVAIGIAGDAGVRGTAEQPR 128

  Fly   131 LFVGMILILIFAEVLGLYGLIVAIYLYTK 159
            |||||:|||||||||.|||||||||||||
  Fly   129 LFVGMVLILIFAEVLALYGLIVAIYLYTK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 V_ATP_synt_C 15..122 CDD:130170 70/106 (66%)
ATP-synt_Vo_c_ATP6C_rpt2 90..157 CDD:349416 51/66 (77%)
Vha16-2NP_729707.1 PRK06558 14..158 CDD:235830 106/146 (73%)
ATP-synt_C 15..120 CDD:294318 70/106 (66%)
ATP-synt_C 94..154 CDD:278563 50/59 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444258
Domainoid 1 1.000 89 1.000 Domainoid score I2684
eggNOG 1 0.900 - - E1_COG0636
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I1314
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - mtm8409
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
1110.910

Return to query results.
Submit another query.