DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-1 and Vha16-4

DIOPT Version :9

Sequence 1:NP_476801.1 Gene:Vha16-1 / 44307 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_611169.1 Gene:Vha16-4 / 36900 FlyBaseID:FBgn0262513 Length:155 Species:Drosophila melanogaster


Alignment Length:156 Identity:106/156 - (67%)
Similarity:131/156 - (83%) Gaps:2/156 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EVSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIA 68
            |:|.|.|....||.::||..||:||.|||||||||:..||::||:..|:||||:|:|||||||||
  Fly     2 ELSLDEPQCASFFCILGAVCAIVFSTLGAAYGTAKASVGISSMSIKHPQLIMKAIVPVVMAGIIA 66

  Fly    69 IYGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFV 133
            |||||:|||:||:|..|  ||.|:||::|.||||||.||:.||.|||:||:||||.:||||:|||
  Fly    67 IYGLVIAVLLAGSLSSP--YSAYKGFLNLSAGLAVGVSGMGAGIAIGVVGEAGVRASAQQPKLFV 129

  Fly   134 GMILILIFAEVLGLYGLIVAIYLYTK 159
            .:|||||||||||||||||||||::|
  Fly   130 AIILILIFAEVLGLYGLIVAIYLFSK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 V_ATP_synt_C 15..122 CDD:130170 70/106 (66%)
ATP-synt_Vo_c_ATP6C_rpt2 90..157 CDD:349416 50/66 (76%)
Vha16-4NP_611169.1 ATP-synt_C 13..118 CDD:294318 70/106 (66%)
ATP-synt_C 93..152 CDD:278563 46/58 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444261
Domainoid 1 1.000 89 1.000 Domainoid score I2684
eggNOG 1 0.900 - - E1_COG0636
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I1314
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - mtm1110
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - P PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
1110.800

Return to query results.
Submit another query.