DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-1 and Vha16-3

DIOPT Version :9

Sequence 1:NP_476801.1 Gene:Vha16-1 / 44307 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001189086.1 Gene:Vha16-3 / 317846 FlyBaseID:FBgn0028667 Length:158 Species:Drosophila melanogaster


Alignment Length:152 Identity:131/152 - (86%)
Similarity:141/152 - (92%) Gaps:2/152 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGL 72
            |.|.|..|||.||||||||||||||||||||||||||||:|||||||||||||||||||||||||
  Fly     9 DKPAYSFFFGSMGAASAIIFSALGAAYGTAKSGTGIAAMAVMRPELIMKSIIPVVMAGIIAIYGL 73

  Fly    73 VVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMIL 137
            ||:|||||:|.:  .|::.:|:|||.|||:|||:|||||||||||||||||||||||||||||||
  Fly    74 VVSVLIAGSLSD--SYTIRKGYIHLAAGLSVGFAGLAAGFAIGIVGDAGVRGTAQQPRLFVGMIL 136

  Fly   138 ILIFAEVLGLYGLIVAIYLYTK 159
            ||||||||||||||||||||||
  Fly   137 ILIFAEVLGLYGLIVAIYLYTK 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 V_ATP_synt_C 15..122 CDD:130170 89/106 (84%)
ATP-synt_Vo_c_ATP6C_rpt2 90..157 CDD:349416 59/66 (89%)
Vha16-3NP_001189086.1 V_ATP_synt_C 16..121 CDD:130170 89/106 (84%)
ATP-synt_Vo_c_ATP6C_rpt2 91..156 CDD:349416 59/64 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444257
Domainoid 1 1.000 96 1.000 Domainoid score I2452
eggNOG 1 0.900 - - E1_COG0636
Homologene 1 1.000 - - H68199
Inparanoid 1 1.050 200 1.000 Inparanoid score I1314
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - mtm6565
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - P PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
1312.810

Return to query results.
Submit another query.