DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-1 and vma11

DIOPT Version :9

Sequence 1:NP_476801.1 Gene:Vha16-1 / 44307 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_593600.1 Gene:vma11 / 2541780 PomBaseID:SPAC732.01 Length:162 Species:Schizosaccharomyces pombe


Alignment Length:159 Identity:97/159 - (61%)
Similarity:123/159 - (77%) Gaps:3/159 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSEVSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAG 65
            |||.:.   |||..|||..|..::::||.|||.||||.:|.||||:...|||::|||:|||||:|
pombe     1 MSSNLC---PIYSSFFGFAGVCASMVFSCLGAGYGTALAGRGIAAVGAFRPEIVMKSLIPVVMSG 62

  Fly    66 IIAIYGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPR 130
            ||.:||||::|||||.:...:.|||:.|||||.||||||.:|:|||:|||:|||.||:...:|.|
pombe    63 IIGVYGLVMSVLIAGDMSPDNDYSLFSGFIHLSAGLAVGLTGVAAGYAIGVVGDRGVQSFMRQDR 127

  Fly   131 LFVGMILILIFAEVLGLYGLIVAIYLYTK 159
            :||.|:||||||||||||||||.:.|.||
pombe   128 IFVSMVLILIFAEVLGLYGLIVGLILQTK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 V_ATP_synt_C 15..122 CDD:130170 65/106 (61%)
ATP-synt_Vo_c_ATP6C_rpt2 90..157 CDD:349416 45/66 (68%)
vma11NP_593600.1 ATP-synt_C 12..119 CDD:294318 65/106 (61%)
ATP-synt_C 93..153 CDD:278563 41/59 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53914
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.