DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-1 and atp6v0ca

DIOPT Version :9

Sequence 1:NP_476801.1 Gene:Vha16-1 / 44307 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001098606.2 Gene:atp6v0ca / 192336 ZFINID:ZDB-GENE-020419-23 Length:154 Species:Danio rerio


Alignment Length:155 Identity:129/155 - (83%)
Similarity:140/155 - (90%) Gaps:2/155 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAI 69
            :.:.||.|.|||.||||:||::|||||||||||||||||||||||||||||||||||||||||||
Zfish     1 MDTQNPQYSPFFAVMGASSAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAI 65

  Fly    70 YGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVG 134
            ||||||||||..:.:  |.|||:.|:||||||:||.|||||||||||||||||||||||||||||
Zfish    66 YGLVVAVLIANNIGD--KISLYKSFLHLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVG 128

  Fly   135 MILILIFAEVLGLYGLIVAIYLYTK 159
            |||||||||||||||||||:.|.||
Zfish   129 MILILIFAEVLGLYGLIVALILSTK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 V_ATP_synt_C 15..122 CDD:130170 89/106 (84%)
ATP-synt_Vo_c_ATP6C_rpt2 90..157 CDD:349416 59/66 (89%)
atp6v0caNP_001098606.2 V_ATP_synt_C 11..116 CDD:130170 89/106 (84%)
PRK14893 12..154 CDD:184887 124/144 (86%)
ATP-synt_C 90..151 CDD:278563 56/60 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576802
Domainoid 1 1.000 109 1.000 Domainoid score I6291
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68199
Inparanoid 1 1.050 244 1.000 Inparanoid score I3275
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - mtm6565
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1636
SonicParanoid 1 1.000 - - X666
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.